IKP

Human Novel Coronavirus Spike glycoprotein(S) 1000 µg

Product no: AS20 4389-1000
2434
Add to cart
Customer reviews
Delivery:  3-6 business days
  • Product Info
  • Format: Lyophilized
    Storage: Store lyophilized/reconstituted at -20°C/-80°C. Reconstitute in deionized sterile water to a concentration from 0.1-1.0 mg/ml and add 5-50% of glycerol (final concentration). 50 % glycerol is a default final recommended concentration. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube. Working aliquotes can be stored at 4℃ for up to one week.Shelf life of liquid form is 6 monthss at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
    Tested applications: ELISA (ELISA)
  • Application Examples
  • Application example

    Functional ELISA for Human Novel Coronavirus Spike glycoprotein (S)

    Functional ELISA showing binding ability. Wells were coated with  SARS-CoV-2-S at 2 μg/ml which can bind SARS-CoV-2-S Antibody (AS20 4386), the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml

    Recombinant Human Novel Coronavirus Spike Glycoprotein (S)

    Recombinant Human Novel Coronavirus Spike glycoprotein (S) was separated on Tris-Glycine gradient SDS-PAGE in reduced conditions. Calculated MW of a target protein is 79.6 kDa, however it migrates at 116 kDa in applied conditions due to glycosylation.
  • Additional Information
  • Additional information (application): N-terminal His tagged Spike glycoprotein (S) (10xHis) and C-terminal FLAG-tagged, was overexpressed in HEK293 mammalian cells using transfection reagent, in the region 16-685 amino acids UniProt: P0DTC2

    VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVS
    GTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNV
    VIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDL
    EGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINI
    TRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVD
    CALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATR
    FASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
    VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLY
    RLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQP
    YRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPF
    QQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVN
    CTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGI
    CASYQTQTNSPRRAR

    Purity: >85 % as confirmed by SDS-PAGE
    Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
  • Background
  • Background: SARS-CoV-2/ 2019-nCoV S protein of Novel Coronavirus (human) its role is to attache the virion to the cell membrane by interacting with host receptor (ACE2) and initiating the infection.

    Alternative names: S, S1, S1-RBD, Spike glycoprotein.
  • Reviews:
  • Reviews
    Below, you can grade the product on a scale from 0 to 5.
    Please also provide information about species, application, dilution and obtained result for the reviewed antibody.
    Your name will be displayed as the sender.
    Number of reviews: (0)

    This product doesn't have any reviews.

Close